VIP (Vasoactive Intestinal Peptide)
VIP is a 28-amino-acid peptide hormone acting as both hormone and neurotransmitter. It induces vasodilation, stimulates heart contractility, relaxes smooth muscles, modulates gastrointestinal function, influences circadian rhythms, and demonstrates anti-inflammatory and immunomodulatory properties. Studied for autoimmune conditions, brain health, and infection control. Available as lyophilized powder with ≥95% purity.
Available SKUs
| Model | Specification | MOQ |
|---|---|---|
| vip-5 | 5ml | 1 vial |
| vip-10 | 10ml | 1 vial |
| vip-20 | 20ml | 1 vial |
Product Overview
VIP is produced in the gut, pancreas, and hypothalamus. It stimulates heart contractions, causes vasodilation, lowers blood pressure, increases glycogen breakdown, relaxes smooth muscle in the trachea, stomach, and gallbladder, and modulates GI motility and secretion. In the brain, it affects blood flow, melatonin production, and circadian rhythm.
Mechanism of Action
VIP binds to VPAC1 and VPAC2 receptors, triggering G-alpha-mediated signaling cascades that increase cAMP and PKA activity. PKA then activates transcriptional factors including CREB, and regulates molecular clock genes Per1 and Per2 for circadian rhythm modulation. VIP is co-released with GABA, influencing neural synchronization.
Key Benefits
Anti-Inflammatory — Decreases most inflammatory cytokines. Shows anti-inflammatory effects in arthritis models and may support immune tolerance by suppressing Th1 and promoting Th2 responses.
Immune Balance — Studied for autoimmune/inflammatory diseases including rheumatoid arthritis, ulcerative colitis, multiple sclerosis, Parkinson's disease, and Crohn's disease.
Brain Health — Neuroprotective properties that increase cellular resistance against oxidative stress, support neuronal survival, and exert anti-anxiety effects.
Antimicrobial Activity — Displays antimicrobial properties against various pathogens including Streptococcus, E. coli, Pseudomonas, and Candida in laboratory studies.
Metabolic Regulation — Influences blood glucose, insulin, and leptin levels. VIP-deficient models show elevated glucose and enhanced sweet taste preference linked to leptin resistance.
References
- Vosko AM, et al. Vasoactive intestinal peptide and the mammalian circadian system. *Gen Comp Endocrinol.* 2007;152(2–3):165–175.
- Maduna T, Lelievre V. Neuropeptides shaping the CNS development: spatiotemporal actions of VIP and PACAP. *J Neurosci Res.* 2016;94(12):1472–1487.
- Kingsbury MA. New perspectives on VIP as a widespread modulator of social behavior. *Curr Opin Behav Sci.* 2015;6:139–147.
| CAS Number | 40077-57-4 |
|---|---|
| Molecular Formula | C147H237N43O43S |
| Molecular Weight | 3326.82 g/mol |
| Sequence/Composition | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Amino Acids | 28 |
| Form | Lyophilized powder |
| Purity | ≥99% by HPLC |
| Storage | -20°C desiccated |
Need OEM or a Custom Configuration?
We offer custom synthesis, modifications, and OEM services. Share your requirements including sequence, purity, quantity, and any special needs—our team will provide a detailed quote.